PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00006.243
Common NameAMTR_s00006p00262710, LOC18434032
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family CO-like
Protein Properties Length: 379aa    MW: 40647 Da    PI: 5.6088
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00006.243genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.21e-052366441
                                  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                                              r C+ +   +  +fC+ ++ +lC  C    H+       H++v 
  evm_27.model.AmTr_v1.0_scaffold00006.243 23 RACESCRAVPSAIFCRADGAYLCTPCDGRVHSAnllasrHQRVL 66
                                              68******99*****************99996688888888775 PP

2zf-B_box22.82e-0766108440
                                  zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40 
                                                 C+ +e  +++l C+ +   lC++C   +H        H + 
  evm_27.model.AmTr_v1.0_scaffold00006.243  66 LLCEVCEAAPASLTCKADAAALCASCDADIHAAnplasrHHRL 108
                                               68*****************************667788886555 PP

3CCT70.73.7e-24309352144
                                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                               Rea++lRY+eKrktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  evm_27.model.AmTr_v1.0_scaffold00006.243 309 REARVLRYREKRKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 352
                                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003369.5E-102067IPR000315B-box-type zinc finger
PROSITE profilePS5011910.2532067IPR000315B-box-type zinc finger
CDDcd000211.00E-62367No hitNo description
PROSITE profilePS5011910.97863110IPR000315B-box-type zinc finger
PfamPF006432.6E-566109IPR000315B-box-type zinc finger
CDDcd000211.46E-867110No hitNo description
SMARTSM003366.3E-868110IPR000315B-box-type zinc finger
PfamPF062035.1E-18309351IPR010402CCT domain
PROSITE profilePS5101716.797309351IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MVKDEDGHPL LLGSGSNAWK TRRACESCRA VPSAIFCRAD GAYLCTPCDG RVHSANLLAS  60
RHQRVLLCEV CEAAPASLTC KADAAALCAS CDADIHAANP LASRHHRLPI LPLSLKSGIQ  120
DRENGNQEED ERESEEEANS WLNIGGGGGG GGGGGGGGER NTVSNGCFYG DVESYLDIDF  180
GVDGINGFEG GEMGMKDGGV GECIVPVQPS NSNNSDCINN NGSQSHMNGN NNSSSCNNLE  240
FLEMEVCKDG YGYTASLSHS VSSSSLDVGV VPEANITDFS ASHLRTSRLG DITTGHPLQM  300
SHQFTPMDRE ARVLRYREKR KTRKFEKTIR YASRKAYAET RPRIKGRFAK RTDVEVEVDQ  360
FYSASLVAET GYGVVPTY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006844170.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
TrEMBLW1PFK40.0W1PFK4_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.27e-29CONSTANS-like 3
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]